Analytical Data
-
Gene name
TNFRSF19L
- Application
-
Alternative Names
TNFRSF19L；TNFRSF19L；Tumor necrosis factor receptor superfamily member 19L
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q969Z4
-
Expression Region
26-160aa
-
AA Sequence
STTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSLWR RLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEWG RRARRGVEVAAGASSGGETRQPGNGTRAGGPEETAVDDIEGRMDEPKSCD KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKC KVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKG FYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGN VFSCSVMHEALHNHYTQKSLSLSPGK
-
Molecular Weight
41 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TNFRSF19L, also known as an orphan member of the tumor necrosis factor receptor superfamily, has gained attention due to its potential roles in immune regulation and inflammation. The reorganization of this protein is crucial for understanding its biological functions and therapeutic applications. Initial studies suggested that TNFRSF19L may be involved in various cellular processes, including apoptosis, cell proliferation, and differentiation. Its expression pattern across different tissues indicates a possible role in immune system modulation and response to inflammatory signals. In recent years, researchers have begun to explore the receptor's interactions with its ligands and downstream signaling pathways, which could reveal new insights into its contribution to autoimmune diseases and cancer. The recombinant protein version of TNFRSF19L allows for detailed functional analyses and provides an opportunity to investigate its potential as a therapeutic target. By characterizing the structure and activity of the recombinant TNFRSF19L, scientists hope to elucidate its mechanism of action and uncover its role in immune cell regulation. This research could pave the way for novel treatments for conditions characterized by dysregulated immune responses. Overall, the study of TNFRSF19L is still in its infancy, and ongoing investigations are essential to fully understand its biological significance and therapeutic potential.
