Analytical Data
-
Gene name
CHST14
- Application
-
Alternative Names
2600016L03Rik; ATCS; Carbohydrate (N acetylgalactosamine 4 0) sulfotransferase 14; Carbohydrate sulfotransferase 14; CHST14; CHSTE_HUMAN; D4ST-1; D4st1; Dermatan 4-sulfotransferase 1; hD4ST1; RP23-286G12.2; UNQ1925/PRO4400
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NCH0
-
Expression Region
1-376aa
-
AA Sequence
MFPRPLTPLAAPNGAEPLGRALRRAPLGRARAGLGGPPLLLPSMLMFAVIVASSGLLLMIERGILAEMKPLPLHPPGREGTAWRGKAPKPGGLSLRAGDADLQVRQDVRNRTLRAVCGQPGMPRDPWDLPVGQRRTLLRHILVSDRYRFLYCYVPKVACSNWKRVMKVLAGVLDSVDVRLKMDHRSDLVFLADLRPEEIRYRLQHYFKFLFVREPLERLLSAYRNKFGEIREYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPERMNEHWMPVYHLCQPCAVHYDFVGSYERLEADANQVLEWVRAPPHVRFPARQAWYRPASPESLHYHLCSAPRALLQDVLPKYILDFSLFAYPLPNVTKEACQQ
-
Molecular Weight
69.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CHST14, also known as carbohydrate sulfotransferase 14, is an enzyme that plays a crucial role in the sulfonation of glycosaminoglycans, particularly in the biosynthesis of heparan sulfate. This post-translational modification is essential for various biological processes, including cell signaling, cell adhesion, and tissue development. Mutations in the CHST14 gene have been linked to conditions such as Ehlers-Danlos syndrome, which underscores its importance in human health. Research on recombinant CHST14 protein has gained traction due to its potential therapeutic applications in tissue engineering and regenerative medicine. By producing and characterizing recombinant CHST14, scientists aim to better understand its enzymatic mechanisms, substrate specificity, and regulatory pathways. Additionally, exploring its functional roles in pathological conditions might contribute to developing novel strategies for diagnosis and treatment. As glycosylation patterns can significantly influence cell behavior and interactions, studying CHST14 offers insights into the intricate network of cellular functions, paving the way for advancements in biomedical research. Overall, the investigation of recombinant CHST14 protein represents a promising avenue for elucidating the complex roles of glycosaminoglycan modifications in health and disease.
