Analytical Data
-
Gene name
PGLYRP1
- Application
-
Alternative Names
PGLYRP1；PGLYRP；PGRP；TNFSF3L；Peptidoglycan recognition Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75594
-
Expression Region
22-196aa
-
AA Sequence
QETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPA SCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHL WNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHR DVQRTLSPGNQLYHLIQNWPHYRSP
-
Molecular Weight
21 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PGLYRP1, or Peptidoglycan Recognition Protein 1, is a crucial component of the innate immune system, primarily involved in recognizing bacterial peptidoglycans and activating various immune responses. Its role in antimicrobial activity and inflammation highlights its potential significance in host defense mechanisms against infections, particularly in the context of bacterial pathogens. Research has shown that PGLYRP1 is expressed in various tissues, including the skin and airways, suggesting its importance in maintaining mucosal immunity. Furthermore, studies indicate that variations in PGLYRP1 expression and function may be linked to a range of inflammatory diseases and infections, emphasizing the need for comprehensive understanding of its molecular mechanisms. The recombinant expression of PGLYRP1 protein has become an important tool for studying its structure-function relationships, interactions with microbial components, and its role in immune signaling pathways. By producing and characterizing recombinant PGLYRP1, researchers can investigate its therapeutic potential, explore its function in disease models, and potentially develop novel strategies for treating infections or modulating immune responses. This research is pivotal not only for basic immunology but also for the development of new vaccines or treatments, especially in an era where antibiotic resistance poses a significant challenge in clinical settings. As such, PGLYRP1 serves as a promising target for both academic research and pharmaceutical applications.
