Analytical Data
-
Gene name
CHST13
- Application
-
Alternative Names
C4ST 3; C4ST-3; C4ST3; Carbohydrate (chondroitin 4) sulfotransferase 13; Carbohydrate sulfotransferase 13; Chondroitin 4 O sulfotransferase 3; Chondroitin 4 sulfotransferase 3; Chondroitin 4-O-sulfotransferase 3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NET6
-
Expression Region
1-225aa
-
AA Sequence
MGRRCCRRRVLAAACLGAALLLLCAAPRSLRPAFGNRALGSSWLGGEKRSPLQKLYDLDQDPRSTLAKVHRQRRDLLNSACSRHSRRQRLLQPEDLRHVLVDDAHGLLYCYVPKVACTNWKRVLLALSGQARGDPRAISAQEAHAPGRLPSLADFSPAEINRRLRAYLAFLFVREPFERLASAYRNKLARTRSATRVASATTSWASSRRWRRTRPSCWAWRAHPT
-
Molecular Weight
51.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CHST13, or carbohydrate sulfotransferase 13, is an enzyme that plays a crucial role in the biosynthesis of sulfated glycosaminoglycans, which are important components of the extracellular matrix and are involved in various biological processes such as cell signaling, tissue repair, and inflammation. Mutations in the CHST13 gene have been associated with developmental disorders, particularly those affecting skeletal and connective tissues. The study of recombinant CHST13 protein is pivotal for understanding its enzymatic mechanisms, substrate specificity, and potential therapeutic applications. By producing CHST13 in a recombinant system, researchers can analyze its structure-function relationship and explore how mutations may impact its activity. Furthermore, the availability of purified recombinant CHST13 allows for in vitro assays to investigate its role in cellular processes and its potential as a target in drug development for diseases linked to glycosaminoglycan dysregulation. Overall, research on CHST13 not only contributes to our understanding of fundamental biological steps but also opens pathways for innovative therapies addressing genetic disorders related to sulfation processes.
