Cat: PA2000-6687

Recombinant Human CHST13 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CHST13

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    C4ST 3; C4ST-3; C4ST3; Carbohydrate (chondroitin 4) sulfotransferase 13; Carbohydrate sulfotransferase 13; Chondroitin 4 O sulfotransferase 3; Chondroitin 4 sulfotransferase 3; Chondroitin 4-O-sulfotransferase 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8NET6

  • Expression Region

    1-225aa

  • AA Sequence

    MGRRCCRRRVLAAACLGAALLLLCAAPRSLRPAFGNRALGSSWLGGEKRSPLQKLYDLDQDPRSTLAKVHRQRRDLLNSACSRHSRRQRLLQPEDLRHVLVDDAHGLLYCYVPKVACTNWKRVLLALSGQARGDPRAISAQEAHAPGRLPSLADFSPAEINRRLRAYLAFLFVREPFERLASAYRNKLARTRSATRVASATTSWASSRRWRRTRPSCWAWRAHPT

  • Molecular Weight

    51.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CHST13, or carbohydrate sulfotransferase 13, is an enzyme that plays a crucial role in the biosynthesis of sulfated glycosaminoglycans, which are important components of the extracellular matrix and are involved in various biological processes such as cell signaling, tissue repair, and inflammation. Mutations in the CHST13 gene have been associated with developmental disorders, particularly those affecting skeletal and connective tissues. The study of recombinant CHST13 protein is pivotal for understanding its enzymatic mechanisms, substrate specificity, and potential therapeutic applications. By producing CHST13 in a recombinant system, researchers can analyze its structure-function relationship and explore how mutations may impact its activity. Furthermore, the availability of purified recombinant CHST13 allows for in vitro assays to investigate its role in cellular processes and its potential as a target in drug development for diseases linked to glycosaminoglycan dysregulation. Overall, research on CHST13 not only contributes to our understanding of fundamental biological steps but also opens pathways for innovative therapies addressing genetic disorders related to sulfation processes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US