Cat: PA2000-3037

Recombinant Human TEAD4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TEAD4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TEAD4;RTEF1;TCF13L1;TEF3;Transcriptional enhancer factor TEF-3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q15561

  • Expression Region

    74-434aa

  • AA Sequence

    MYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAK DKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGT SHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSK LWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDK FPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESP ENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINF IHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHG AQHHIYRLVKE

  • Molecular Weight

    45 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TEAD4 (TEA Domain Transcription Factor 4) is a member of the TEAD family of transcription factors, which play a crucial role in various biological processes, including cell proliferation, differentiation, and tissue development. TEAD4 functions primarily by binding to enhancers and promoters of target genes, often in cooperation with co-activators like Yes-associated protein (YAP) and transcriptional co-activator with PDZ-binding motif (TAZ). Dysregulation of TEAD4 and its associated pathways has been implicated in several diseases, particularly cancer, where its interaction with YAP/TAZ promotes oncogenic signaling. As a result, understanding the structural and functional characteristics of TEAD4 through recombinant protein studies is essential for elucidating its role in cellular processes and disease mechanisms. The production of recombinant TEAD4 protein allows researchers to investigate its binding affinities, interactions with other proteins, and transcriptional activities in vitro. Such studies can facilitate the identification of potential therapeutic targets for cancer and other diseases associated with aberrant TEAD4 signaling. Overall, TEAD4 represents a critical node in developmental biology and pathology, making it a significant focus of ongoing research aimed at unraveling its regulatory networks and therapeutic potential.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US