Analytical Data
-
Gene name
RGMA
- Application
-
Alternative Names
RGMA；RGM；Repulsive guidance molecule A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96B86
-
Expression Region
169-422aa
-
AA Sequence
MNHKVHHHHHHMPHLRTFTDRFQTCKVQGAWPLIDNNYLNVQVTNTPVLP GSAATATSKLTIIFKNFQECVDQKVYQAEMDELPAAFVDGSKNGGDKHGA NSLKITEKVSGQHVEIQAKYIGTTIVVRQVGRYLTFAVRMPEEVVNAVED WDSQGLYLCLRGCPLNQQIDFQAFHTNAEGTGARRLAAASPAPTAPETFP YETAVAKCKEKLPVEDLYYQACVFDLLTTGDVNFTLAAYYALEDVKMLHS NKDKLHLYER TRDLPG
-
Molecular Weight
30 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RGMa (Repulsive Guidance Molecule a) is a member of the repulsive guidance molecule family, originally identified for its role in neural development and axon guidance. Recent studies have revealed that RGMa is not only crucial in the nervous system but also plays significant roles in various biological processes, including immune response, cell migration, and tissue repair. In the context of disease, RGMa has been implicated in conditions such as multiple sclerosis, where it contributes to axonal degeneration, and cancer, where it can influence tumor progression and metastasis. The study of RGMa has gained traction due to its potential as a therapeutic target. Researchers are exploring the production of recombinant RGMa proteins to better understand its structure-function relationships and develop potential interventions that modulate its activity. Advances in recombinant DNA technology allow for the expression of RGMa in various systems, facilitating the generation of high-purity proteins for detailed functional assays. This research not only aims to elucidate the mechanisms underlying RGMa's role in health and disease but also seeks to harness its properties for innovative therapeutic strategies, highlighting its promise in regenerative medicine and cancer therapy.
