Cat: PA2000-3036

Recombinant Human SEPTIN2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SEPTIN2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SEPTIN2;DIFF6;KIAA0158;NEDD5;Septin-2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q15019

  • Expression Region

    1-361aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMSKQQPTQFINPETPGYVGFANLPNQVHRK SVKKGFEFTLMVVGESGLGKSTLINSLFLTDLYPERVISGAAEKIERTVQ IEASTVEIEERGVKLRLTVVDTPGYGDAINCRDCFKTIISYIDEQFERYL HDESGLNRRHIIDNRVHCCFYFISPFGHGLKPLDVAFMKAIHNKVNIVPV IAKADTLTLKERERLKKRILDEIEEHNIKIYHLPDAESDEDEDFKEQTRL LKASIPFSVVGSNQLIEAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTML ITHMQDLQEVTQDLHYENFRSERLKRGGRKVENEDMNKDQILLEKEAELR RMQEMIARMQAQMQMQMQGGDGDGGALGHHV

  • Molecular Weight

    44 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SEPTIN2, a member of the septin family of GTP-binding proteins, plays a critical role in various cellular processes, including cytokinesis, cell division, and the establishment of cellular architecture. These proteins can form hetero-oligomeric complexes and are involved in the regulation of membrane dynamics and the organization of the cytoskeleton. Specifically, SEPTIN2 has emerged as a key player in cytokinesis, where it aids in the formation of the septin ring—a structure crucial for the successful division of cells. Dysregulation of SEPTIN2 has been implicated in numerous diseases, including cancer and neurodegenerative disorders, highlighting its potential as a therapeutic target. Research efforts have focused on recombinantly expressing SEPTIN2 to elucidate its structural properties and interactions with other proteins. By studying its biochemical characteristics and cellular localization, researchers aim to define its functional roles and the molecular mechanisms by which it contributes to cell cycle regulation and disease progression. Understanding SEPTIN2 through recombinant protein studies not only enhances our knowledge of its biological importance but also opens avenues for developing novel therapeutic strategies aimed at modulating its activity in pathological conditions. As interest in the septins continues to grow, the exploration of SEPTIN2 provides valuable insights into the intricate interplay between cytoskeletal dynamics and cellular function.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US