Analytical Data
-
Gene name
SCN2B
- Application
-
Alternative Names
SCN2B; UNQ326/PRO386; Sodium channel subunit beta-2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O60939
-
Expression Region
1-215 aa
-
AA Sequence
MHRDAWLPRPAFSLTGLSLFFSLVPPGRSMEVTVPATLNVLNGSDARLPCTFNSCYTVNHKQFSLNWTYQECNNCSEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPEDEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVAVIVGASVGGFLAVVILVLMVVKCVRRKKEQKLSTDDLKTEEEGKTDGEGNPDDGAK
-
Molecular Weight
49.39 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SCN2B is a gene encoding the beta-2 subunit of voltage-gated sodium channels, which play a crucial role in the propagation of action potentials in neurons. Mutations in SCN2B have been implicated in various neurological disorders, including epilepsy, autism spectrum disorders, and other neurodevelopmental conditions. The research surrounding SCN2B recombinant proteins has gained momentum due to their potential in understanding the physiological and pathological roles of sodium channels in neuronal excitability. By producing and studying these recombinant proteins, researchers aim to elucidate the functional mechanisms of SCN2B and its interaction with the alpha subunits of sodium channels. This understanding is essential for developing targeted therapies for sodium channel-related disorders. Moreover, the investigation of SCN2B’s contributions to channel gating, ion permeability, and modulation by auxiliary proteins could provide insights into the intricate signaling networks in the nervous system. Overall, the study of SCN2B recombinant proteins represents a promising avenue for advancing our knowledge of neuronal function and developing innovative therapeutic strategies for neurological diseases.











