Analytical Data
-
Gene name
SCN2A2
- Application
-
Alternative Names
HBSC II; NAC2; Scn2a; SCN2A_HUMAN; SCN2A1; SCN2A2; Sodium channel protein brain II subunit alpha; Sodium channel protein type 2 subunit alpha; Sodium channel protein type II subunit alpha; Sodium channel protein. brain II subunit alpha; Voltage gated sodium channel subunit alpha Nav1.2; Voltage-gated sodium channel subunit alpha Nav1.2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99250
-
Expression Region
273-362 aa
-
AA Sequence
NLRNKCLQWPPDNSSFEINITSFFNNSLDGNGTTFNRTVSIFNWDEYIEDKSHFYFLEGQNDALLCGNSSDAGQCPEGYICVKAGRNPNY
-
Molecular Weight
35.64 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SCN2A is a gene that encodes the alpha subunit of the voltage-gated sodium channel NaV1.2, which plays a crucial role in initiating and propagating action potentials in neurons. Mutations in SCN2A have been linked to various neurodevelopmental disorders, including epilepsy, intellectual disability, and autism spectrum disorder. Given the clinical significance of these mutations, there has been considerable interest in the functional characterization of recombinant SCN2A proteins. These studies aim to elucidate how specific mutations affect sodium channel biophysics, impacting neuronal excitability and overall brain function. Research on SCN2A recombinant proteins not only provides insights into the mechanisms underlying associated pathologies but also aids in the development of targeted therapies. By generating and analyzing these recombinant proteins in heterologous systems, scientists can assess the effects of mutations on channel function, including ion conductance, voltage dependence, and channel kinetics. Understanding the structure-function relationship of SCN2A can reveal critical targets for pharmacological intervention, offering hope for effective treatments for individuals affected by SCN2A-related conditions.
