Analytical Data
-
Gene name
SMT3
- Application
-
Alternative Names
SMT3;SMT3A;SMT3H1;Small ubiquitin-related modifier 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q12306
-
Expression Region
2-98aa
-
AA Sequence
SDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEA FAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG
-
Molecular Weight
27 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SMT3, a member of the ubiquitin-like protein family, plays a crucial role in various cellular processes, including protein degradation, cell cycle regulation, and stress response. Research on SMT3 protein, particularly its role in post-translational modifications and cellular signaling pathways, has gained traction in recent years due to its potential implications in diseases such as cancer and neurodegenerative disorders. The ability of SMT3 to modify target proteins influences their stability, localization, and activity, making it a key player in maintaining cellular homeostasis. Moreover, the reconstitution of SMT3 and its interactions with other proteins provide valuable insights into the molecular mechanisms underlying protein turnover and cellular regulation. As the understanding of SMT3's functions expands, it offers promising avenues for therapeutic interventions by targeting the pathways it modulates. Hence, the study of SMT3 recombinant proteins is not only significant for basic biological research but also for the development of novel strategies in disease treatment and prevention.











