Analytical Data
-
Gene name
SCN1B
- Application
-
Alternative Names
Sodium channel regulatory subunit beta-1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q07699
-
Expression Region
1-218 aa
-
AA Sequence
MGRLLALVVGAALVSSACGGCVEVDSETEAVYGMTFKILCISCKRRSETNAETFTEWTFRQKGTEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTKDLQDLSIFITNVTYNHSGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKANRDMASIVSEIMMYVLIVVLTIWLVAEMIYCYKKIAAATETAAQENASEYLAITSESKENCTGVQVAE
-
Molecular Weight
49.61 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SCN1B, encoding the sodium channel beta-1 subunit, plays a crucial role in the modulation of voltage-gated sodium channels, impacting neuronal excitability and action potential propagation. Mutations or dysregulation of SCN1B are associated with various neurological disorders, particularly genetic epilepsy syndromes such as Dravet syndrome. Research into SCN1B recombinant proteins is essential for understanding the functional consequences of specific mutations, as well as their interactions with alpha subunits of sodium channels and other proteins. By using recombinant DNA technology, scientists can produce and purify SCN1B proteins to study their biochemical properties and physiological roles in cellular models. This analysis provides insights into the mechanisms underlying sodium channel dysfunctions and their contribution to epilepsy pathophysiology, paving the way for potential therapeutic strategies targeting sodium channel activity. Moreover, examining SCN1B in the context of its interactions with different channel subtypes and other auxiliary proteins maximizes our understanding of neuronal signaling and its implications in disease states. This research holds promise for identifying novel biomarkers and developing targeted interventions for patients suffering from sodium channel-related disorders.
