Analytical Data
-
Gene name
CGI-121
- Application
-
Alternative Names
CGI 121 ; My019 ; PRPK (p53 related Protein kinase) binding Protein ; PRPK-binding Protein; TP53RK binding Protein; TP53RK-binding Protein; Tprkb; TPRKB_HUMAN
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y3C4
-
Expression Region
1-175aa
-
AA Sequence
MQLTHQLDLFPECRVTLLLFKDVKNAGDLRRKAMEGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKMKTRTLSTEIIFNLSPNNNISEALKKFGISANDTSILIVYIEEGEKQINQEYLISQVEGHQVSLKNLPEIMNITEVKKIYKLSSQEESIGTLLDAIICRMSTKDVL
-
Molecular Weight
46.1 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CGI-121 is a recombinant protein that has garnered significant attention in the field of biomedical research due to its potential applications in cancer therapy and immunology. As a member of the C-type lectin receptor family, CGI-121 plays a pivotal role in mediating immune responses and modulating inflammation. Its unique structural properties allow it to interact with specific carbohydrate patterns on the surface of pathogens and tumor cells, thereby influencing immune cell activation and cytokine production. Recent studies have indicated that CGI-121 may enhance the efficacy of existing cancer treatments by promoting anti-tumor immunity and reducing immune evasion by tumors. Additionally, research has explored its potential as a therapeutic target, leading to the development of novel drugs that can either mimic or inhibit its function. The ongoing investigation into the biological mechanisms and clinical implications of CGI-121 is paving the way for innovative approaches to treat various cancers and autoimmune diseases. Overall, the study of CGI-121 is essential for advancing our understanding of immune regulation and improving therapeutic strategies.
