Analytical Data
-
Gene name
SCAMP1
- Application
-
Alternative Names
SCAMP1; SCAMP; Secretory carrier-associated membrane protein 1; Secretory carrier membrane protein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15126
-
Expression Region
1-338 aa
-
AA Sequence
MSDFDSNPFADPDLNNPFKDPSVTQVTRNVPPGLDEYNPFSDSRTPPPGGVKMPNVPNTQPAIMKPTEEHPAYTQIAKEHALAQAELLKRQEELERKAAELDRREREMQNLSQHGRKNNWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVKLMYYLWMFHAVTLFLNIFGCLAWFCVDSARAVDFGLSILWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNQNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSNKTVQTAAANAASTAASSAAQNAFKGNQI
-
Molecular Weight
62.92 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SCAMP1 (Secretory Carrier Membrane Protein 1) is an integral membrane protein that plays a crucial role in the transport of secretory proteins and membrane recycling within cells. It is involved in various cellular processes, including endocytosis and exocytosis, thereby influencing the dynamics of membrane trafficking. Research into SCAMP1 has garnered interest due to its potential implications in cellular signaling pathways and its association with various diseases, including cancer and neurological disorders. The ability to produce recombinant SCAMP1 protein is vital for investigating its structural and functional properties, as well as understanding its interaction with other cellular components. Recombinant protein techniques enable scientists to obtain SCAMP1 in a purified form, allowing for detailed studies on its role in membrane dynamics and cellular transport processes. The exploration of SCAMP1's mechanisms may also provide insights into therapeutic targets and strategies for diseases linked to membrane trafficking dysregulation. Additionally, studying SCAMP1 could enhance our understanding of secretory processes critical for maintaining cell homeostasis and communication. Given its significance in cell biology and pathology, the characterization of SCAMP1 through recombinant expression systems holds promise for advancing our knowledge in these areas.
