Analytical Data
-
Gene name
RBL2
- Application
-
Alternative Names
RBL2；RB2；Retinoblastoma-like Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q08999
-
Expression Region
417-616aa
-
AA Sequence
TPVSTATHSLSRLHTMLTGLRNAPSEKLEQILRTCSRDPTQAIANRLKEMFEIYSQHFQPDEDFSNCAKEIASKHFRFAEMLYYKVLESVIEQEQKRLGDMDLSGILEQDAFHRSLLACCLEVVTFSYKPPGNFPFITEIFDVPLYHFYKVIEVFIRAEDGLCREVVKHLNQIEEQILDHLAWKPESPLWEKIRDNENRV
-
Molecular Weight
27.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RBL2, also known as Retinoblastoma-Like Protein 2, is a member of the retinoblastoma protein family, which plays a critical role in cell cycle regulation and tumor suppression. Research on RBL2 has gained significant attention due to its involvement in various cellular processes, including cell proliferation, differentiation, and apoptosis. Unlike its well-studied counterpart, the RB1 protein, RBL2 has distinct yet overlapping functions in the regulation of gene expression and cellular signaling pathways. Alterations in RBL2 expression or function have been implicated in several types of cancers, highlighting its potential as a biomarker or therapeutic target. Recent studies have focused on the characterization of RBL2's molecular interactions, post-translational modifications, and its regulatory effects on key oncogenic pathways. The recombinant expression of RBL2 protein facilitates in-depth studies of its structural properties and functional mechanisms, paving the way for novel insights into its biological roles. As the understanding of RBL2's significance in cancer biology continues to evolve, ongoing research aims to elucidate its potential as a therapeutic target, provide insights into its role in tumorigenesis, and explore its utility in developing targeted cancer therapies.
