Analytical Data
-
Gene name
ASGPR1
- Application
-
Alternative Names
ASGPR1；
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P07306
-
Expression Region
62-291aa
-
AA Sequence
QNSQLQEELRGLRETFSNFTASTEAQVKGLSTQGGNVGRKMKSLESQLEK QQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGSERTCCPVNWVEH ERSCYWFSRSGKAWADADNYCRLEDAHLVVVTSWEEQKFVQHHIGPVNTW MGLHDQNGPWKWVDGTDYETGFKNWRPEQPDDWYGHGLGGGEDCAHFTDD GRWNDDVCQRPYRWVCETELDKASQEPPLLVDHHHHHH
-
Molecular Weight
27 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ASGPR1 (asialoglycoprotein receptor 1) is a receptor predominantly expressed in liver cells, playing a crucial role in the endocytosis of desialylated glycoproteins. Research on ASGPR1 has gained significant attention due to its potential applications in targeted drug delivery and cancer therapy. The receptor recognizes and binds to specific glycan structures on the surface of glycoproteins, leading to their selective uptake by hepatocytes. This property has been leveraged to design recombinant proteins and nanoparticles that can selectively deliver therapeutic agents to the liver, thereby enhancing the efficacy and reducing systemic side effects of treatments for liver-related diseases and tumors. Furthermore, understanding the structural and functional characteristics of ASGPR1 is essential for the development of novel therapeutic strategies, including vaccines and gene therapies. Recent studies have focused on the optimization of ASGPR1-targeting ligands and the engineering of recombinant proteins that improve binding affinity and specificity. As the exploration of ASGPR1 continues, it represents a promising frontier in biomedicine, with the potential to revolutionize liver-targeted therapies and broaden the scope of available treatment options for various diseases.
