Analytical Data
-
Gene name
SECTM1
- Application
-
Alternative Names
SECTM1;K12;Secreted and transmembrane Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WVN6
-
Expression Region
29-145aa
-
AA Sequence
QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIF NEVAPGYFSR DGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNN RQVTLEVSGAEPQSAPDTG
-
Molecular Weight
14 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SECTM1, a member of the SECTM family, encodes a protein that plays a critical role in cell signaling and immune responses. Research into SECTM1 has garnered attention due to its potential implications in various physiological and pathological processes. It is predominantly expressed in immune cells and has been implicated in regulating T cell activity and modulating inflammatory responses. Studies suggest that SECTM1 may influence tumor immune evasion and contribute to the progression of certain cancers. Additionally, its expression levels have been associated with autoimmune diseases, highlighting its relevance in immune regulation. Understanding the structure-function relationship of the SECTM1 protein and its interaction with other cellular components is essential for elucidating its role in health and disease. The recombinant expression of SECTM1 protein allows for detailed characterization and investigation of its biological functions. Such studies could lead to potential therapeutic applications, including the development of novel immunomodulatory strategies for cancer treatment and management of autoimmune conditions. As researchers continue to explore the intricacies of SECTM1, it remains a promising candidate for advancing our understanding of immune system dynamics and the potential for targeted interventions.











