Cat: PA1000-6769

Recombinant Human SECTM1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SECTM1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SECTM1;K12;Secreted and transmembrane Protein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8WVN6

  • Expression Region

    29-145aa

  • AA Sequence

    QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIF NEVAPGYFSR DGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNN RQVTLEVSGAEPQSAPDTG

  • Molecular Weight

    14 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SECTM1, a member of the SECTM family, encodes a protein that plays a critical role in cell signaling and immune responses. Research into SECTM1 has garnered attention due to its potential implications in various physiological and pathological processes. It is predominantly expressed in immune cells and has been implicated in regulating T cell activity and modulating inflammatory responses. Studies suggest that SECTM1 may influence tumor immune evasion and contribute to the progression of certain cancers. Additionally, its expression levels have been associated with autoimmune diseases, highlighting its relevance in immune regulation. Understanding the structure-function relationship of the SECTM1 protein and its interaction with other cellular components is essential for elucidating its role in health and disease. The recombinant expression of SECTM1 protein allows for detailed characterization and investigation of its biological functions. Such studies could lead to potential therapeutic applications, including the development of novel immunomodulatory strategies for cancer treatment and management of autoimmune conditions. As researchers continue to explore the intricacies of SECTM1, it remains a promising candidate for advancing our understanding of immune system dynamics and the potential for targeted interventions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US