Analytical Data
-
Gene name
CEP27
- Application
-
Alternative Names
HAUS2; C15orf25; CEP27; HAUS augmin-like complex subunit 2; Centrosomal Protein of 27 kDa; Cep27
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NVX0
-
Expression Region
1-235aa
-
AA Sequence
MAAANPWDPASAPNGAGLVLGHFIASGMVNQEMLNMSKKTVSCFVNFTRLQQITNIQAEIYQKNLEIELLKLEKDTADVVHPFFLAQKCHTLQSMNNHLEAVLKEKRSLRQRLLKPMCQENLPIEAVYHRYMVHLLELAVTFIERLETHLETIRNIPHLAANLKKMNQALAKMDILVTETEELAENILKWRKQQNEVSSCIPKILAEESYLYKHDIIMPPLPFTSKVHVQTINAK
-
Molecular Weight
53.3 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CEP27 (Centrosomal Protein 27 kDa) is a protein that plays a crucial role in cell cycle regulation and the function of centrosomes, which are essential for proper mitotic spindle formation and chromosome segregation. Aberrations in centrosomal function can lead to a variety of diseases, including cancer and genetic disorders. Research on CEP27 has garnered attention due to its potential implications in these areas. Studies have shown that CEP27 is involved in various cellular processes, including cytokinesis and DNA damage response. Understanding the molecular mechanisms by which CEP27 operates could provide insights into its function in cell division and the pathological consequences of its malfunction. In addition, the recombinant production of CEP27 has enabled researchers to explore its structure, interactions, and functional roles in vitro, providing a valuable tool for functional assays and therapeutic developments. Given the increasing recognition of centrosomal proteins as key players in oncogenesis and other diseases, CEP27 represents a promising target for further study, enabling the potential identification of novel biomarkers and therapeutic strategies aimed at improving cancer treatment and addressing other related disorders. This area of research is critical not only for basic cell biology but also for translational medicine, as elucidating the role of CEP27 in pathophysiology could open new avenues for intervention in diseases linked to centrosomal dysfunction.
