Analytical Data
-
Gene name
VENTX
- Application
-
Alternative Names
VENTX；HPX42B；VENTX2；Homeobox Protein VENTX
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95231
-
Expression Region
1-258aa
-
AA Sequence
MRLSSSPPRGPQQLSSFGSVDWLSQSSCSGPTHTPRPADFSLGSLPGPGQTSGAREPPQAVSIKEAAGSSNLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLERKRLAREMQLSEVQIKTWFQNRRMKHKRQMQDPQLHSPFSGSLHAPPAFYSTSSGLANGLQLLCPWAPLSGPQALMLPPGSFWGLCQVAQEALASAGASCCGQPLASHPPTPGRPSLGPALSTGPRGLCAMPQTGDAF
-
Molecular Weight
54.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
VENTX is a recombinant protein that has garnered significant interest in the field of biotechnology and molecular biology. The research surrounding VENTX is primarily rooted in its potential applications in therapeutic development, diagnostics, and basic research. As a recombinant protein, VENTX is produced using advanced genetic engineering techniques, allowing for the precise manipulation of its structure and function. This specificity is crucial for studying protein interactions and cellular processes. Researchers are exploring VENTX for its role in various biological pathways, as it may serve as an innovative tool for understanding disease mechanisms, particularly in areas such as cancer, autoimmune disorders, and infectious diseases. The growing demand for more efficient therapeutic proteins has propelled VENTX into the spotlight, highlighting its advantages in terms of scalability and consistency in production. Additionally, VENTX represents a promising avenue for vaccine development, as recombinant proteins can elicit robust immune responses without the risk associated with live pathogens. The ongoing studies aim to unravel the full potential of VENTX in therapeutic contexts, leading to the development of novel biopharmaceuticals that could offer better treatment options for patients. As the understanding of VENTX continues to evolve, it stands to contribute significantly to the advancement of medical science, paving the way for innovative solutions in healthcare.
