Analytical Data
-
Gene name
CEP120
- Application
-
Alternative Names
CCDC100; CE120_HUMAN; Centrosomal Protein of 120 kDa; Cep120; Coiled-coil domain-containing Protein 100
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N960
-
Expression Region
1-380aa
-
AA Sequence
MVSKSDQLLIVVSILEGRHFPKRPKHMLVVEAKFDGEQLATDPVDHTDQPEFATELAWEIDRKALHQHRLQRTPIKLQCFALDPVTSAKETIGYIVLDLRTAQETKQAPKWYQLLSNKYTKFKSEIQISIALETDTKPPVDSFKAKGAPPRDGKVPAILAGLDPRDIVAVLNEEGGYHQIGPAEYCTDSFIMSVTIAFATQLEQLIPCTMKLPERQPEFFFYYSLLGNDVTNEPFNDLINPNFEPERASVRIRSSVEILRVYLALQSKLQIHLCCGDQSLGSTEIPLTGLLKKGSTEINQHPVTVEGAFTLDPPNRAKQKLAPIPVELAPTVGVSVALQREGIDSQDAFWYSALDIIFPLFIFLFLVLDAIRKFANYEEK
-
Molecular Weight
69.1 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CEP120, a protein encoded by the CEP120 gene, plays a crucial role in the formation and maintenance of cilia, microtubule-based organelles found on the surface of many eukaryotic cells. Research suggests that CEP120 is involved in the assembly of the ciliary axoneme, a structure critical for ciliary function. Mutations in the CEP120 gene have been associated with various ciliopathies, a group of genetic disorders that arise from dysfunction in cilia, leading to a range of clinical manifestations such as retinitis pigmentosa, nephronophthisis, and skeletal abnormalities. Understanding the molecular mechanisms underlying CEP120 function can provide insights into the pathogenesis of these ciliopathies and may identify potential therapeutic targets for treatment. Recent studies have focused on characterizing the interactions of CEP120 with other proteins involved in the ciliary assembly process and exploring its role in the regulation of centrosome dynamics. Furthermore, advances in imaging techniques and genetic editing tools have facilitated the in-depth examination of CEP120’s function in cellular models, highlighting its importance in ciliary biogenesis and cellular signaling pathways. As research continues to elucidate the complex biological roles of CEP120, it holds promise for advancing our knowledge of cilia-related diseases and developing innovative interventions.











