Analytical Data
-
Gene name
CEP112
- Application
-
Alternative Names
CEP112; CCDC46Centrosomal Protein of 112 kDa; Cep112; Coiled-coil domain-containing Protein 46
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N8E3
-
Expression Region
1-211aa
-
AA Sequence
MWASLSLDHPSAKENQALRLIEMREENGNVPKTEQAGSLKPLRDTGKSNLKEKKANSKLKQIEKEYTQKLAKSSQIIAELQTTISSLKEENSQQQLAAERRLQDVRQKFEDEKKQLIRDNDQAIKVLQDELENRSNQVRCAEKKLQHKELESQEQITYIRQEYETKLKGLMPASLRQELEDTISSLKSQVNFLQKRASILQEELTTYQGRR
-
Molecular Weight
50.9 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CEP112 (Centrosomal Protein 112) is a protein crucial for the correct functioning of the centrosome, which plays a key role in cell division and maintaining cellular architecture. As a component of the centrosome, CEP112 has been implicated in various cellular processes, including microtubule organization and spindle assembly. Mutations or dysregulation of CEP112 have been associated with various diseases, including cancer and neurological disorders, highlighting its importance in cellular integrity and function. Recent research has focused on the expression, localization, and functional mechanisms of CEP112, particularly in the context of its role in centrosome dynamics during the cell cycle. Understanding the structure and function of CEP112 through recombinant protein studies can provide insights into its biological significance and potential as a therapeutic target. Studies using recombinant CEP112 allow for detailed analysis of its biochemical properties, interactions with other centrosomal proteins, and its involvement in pathophysiological conditions. As such, the investigation of CEP112 through recombinant protein technology continues to be an important area of study in cell biology and molecular medicine, potentially leading to advancements in treatment strategies for centrosome-related diseases.
