Cat: PA2000-6647

Recombinant Human CEP112 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CEP112

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CEP112; CCDC46Centrosomal Protein of 112 kDa; Cep112; Coiled-coil domain-containing Protein 46

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8N8E3

  • Expression Region

    1-211aa

  • AA Sequence

    MWASLSLDHPSAKENQALRLIEMREENGNVPKTEQAGSLKPLRDTGKSNLKEKKANSKLKQIEKEYTQKLAKSSQIIAELQTTISSLKEENSQQQLAAERRLQDVRQKFEDEKKQLIRDNDQAIKVLQDELENRSNQVRCAEKKLQHKELESQEQITYIRQEYETKLKGLMPASLRQELEDTISSLKSQVNFLQKRASILQEELTTYQGRR

  • Molecular Weight

    50.9 KDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CEP112 (Centrosomal Protein 112) is a protein crucial for the correct functioning of the centrosome, which plays a key role in cell division and maintaining cellular architecture. As a component of the centrosome, CEP112 has been implicated in various cellular processes, including microtubule organization and spindle assembly. Mutations or dysregulation of CEP112 have been associated with various diseases, including cancer and neurological disorders, highlighting its importance in cellular integrity and function. Recent research has focused on the expression, localization, and functional mechanisms of CEP112, particularly in the context of its role in centrosome dynamics during the cell cycle. Understanding the structure and function of CEP112 through recombinant protein studies can provide insights into its biological significance and potential as a therapeutic target. Studies using recombinant CEP112 allow for detailed analysis of its biochemical properties, interactions with other centrosomal proteins, and its involvement in pathophysiological conditions. As such, the investigation of CEP112 through recombinant protein technology continues to be an important area of study in cell biology and molecular medicine, potentially leading to advancements in treatment strategies for centrosome-related diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US