Analytical Data
-
Gene name
RBP47A
- Application
-
Alternative Names
RBP47A；Polyadenylate-binding Protein RBP47A
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
F4I3B3
-
Expression Region
1-445aa
-
AA Sequence
MQTPNNNGSTDSVLPPTSAGTTPPPPLQQSTPPPQQQQQQQWQQQQQWMAAMQQYPAAAMAMMQQQQMMMYPHPQYAPYNQAAYQQHPQFQYAAYQQQQQQHHQSQQQPRGGSGGDDVKTLWVGDLLHWMDETYLHTCFSHTNEVSSVKVIRNKQTCQSEGYGFVEFLSRSAAEEALQSFSGVTMPNAEQPFRLNWASFSTGEKRASENGPDLSIFVGDLAPDVSDAVLLETFAGRYPSVKGAKVVIDSNTGRSKGYGFVRFGDENERSRAMTEMNGAFCSSRQMRVGIATPKRAAAYGQQNGSQALTLAGGHGGNGSMSDGESNNSTIFVGGLDADVTEEDLMQPFSDFGEVVSVKIPVGKGCGFVQFANRQSAEEAIGNLNGTVIGKNTVRLSWGRSPNKQWRSDSGNQWNGGYSRGQGYNNGYANQDSNMYATAAAAVPGAS
-
Molecular Weight
53.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RBP47A, also known as RNA binding protein 47A, is a member of the heterogeneous nuclear ribonucleoprotein (hnRNP) family that plays a significant role in RNA metabolism, including splicing, transport, and stability. Research into RBP47A has gained momentum due to its potential involvement in various cellular processes and its association with diseases, particularly cancers and neurodegenerative disorders. The protein is known to interact with specific RNA sequences and is thought to be crucial for the regulation of gene expression at the post-transcriptional level. Understanding the functional mechanisms of RBP47A is essential for elucidating its role in pathological conditions and for developing potential therapeutic strategies. Moreover, the generation of recombinant RBP47A protein facilitates the study of its biochemical properties, interactions with RNA, and the identification of downstream molecular targets. This approach opens up avenues for investigating how this protein influences cellular pathways and contributes to disease contexts, thereby advancing our understanding of RNA-binding proteins' roles within the broader landscape of molecular biology and genetics.
