Analytical Data
-
Gene name
CD8B1
- Application
-
Alternative Names
CD8B; CD8B1; T-cell surface glycoProtein CD8 beta chain; CD antigen CD8b
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P10966
-
Expression Region
1-243aa
-
AA Sequence
MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPITLGLLVAGVLVLLVSLGVAIHLCCRRRRARLRFMKQPQGEGISGTFVPQCLHGYYSNTTTSQKLLNPWILKT
-
Molecular Weight
53.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD8B1 is a crucial protein that plays a significant role in the immune response by serving as a co-receptor on the surface of cytotoxic T lymphocytes (CTLs). It interacts with the major histocompatibility complex (MHC) class I molecules, enhancing the activation and proliferation of CTLs, which are vital for the recognition and elimination of virus-infected cells and tumor cells. Research on CD8B1 has gained momentum due to its potential implications in immunotherapy and vaccine development. Abnormal expression or dysfunction of CD8B1 has been associated with various diseases, including autoimmune disorders and cancer, where it can impact T cell activation, differentiation, and overall immune surveillance. The reconstitution of CD8B1 protein through recombinant technology allows for in-depth studies of its structure, function, and interactions within the immune system. Moreover, understanding the nuances of CD8B1 signaling pathways may pave the way for novel therapeutic strategies aimed at modulating immune responses in various clinical settings. This pursuit is essential for enhancing the efficacy of existing immunotherapies and developing new approaches to treat diseases characterized by inadequate or dysregulated immune responses. Overall, the study of CD8B1 recombinant proteins represents a crucial area of research that bridges immunology and therapeutic development, with the potential for significant advancements in the treatment of malignancies and infectious diseases.
