Analytical Data
-
Gene name
CD84
- Application
-
Alternative Names
SLAM family member 5. Cell surface antigen MAX.3. Hly9-beta. Leukocyte differentiation antigen CD84. Signaling lymphocytic activation molecule 5. CD84
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UIB8
-
Expression Region
1-328aa
-
AA Sequence
MAQHHLWILLLCLQTWPEAAGKDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRTHHTGLLSVLAMFFLLVLILSSVFLFRLFKRRQDAASKKTIYTYIMASRNTQPAESRIYDEILQSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTSSYEIVI
-
Molecular Weight
63.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD84 is a member of the signaling lymphocytic activation molecule (SLAM) family, which plays a crucial role in immune response regulation. It is primarily expressed on the surface of immune cells, such as T cells, B cells, and dendritic cells. Research into CD84 has gained significance due to its potential involvement in immune-related diseases, including autoimmune disorders and cancer. The understanding of CD84's functions and its interactions with other immune receptors has led to increasing interest in developing recombinant proteins for therapeutic applications. These recombinant CD84 proteins can be used as tools in studies to elucidate the signaling pathways and mechanisms by which CD84 modulates immune responses. Additionally, they may serve as potential biomolecular agents for targeting specific immune pathways, thus offering new avenues for treatment strategies in diseases characterized by dysregulated immune activation. Overall, the investigation of CD84 recombinant proteins represents a promising frontier in immunology, holding the potential to enhance our understanding of immune regulation and contribute to novel therapeutic interventions.











