Analytical Data
-
Gene name
glcC
- Application
-
Alternative Names
glcC;Collagen alpha-1(XVIII) chain
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0ACL6
-
Expression Region
1-254aa
-
AA Sequence
MKDERRPICEVVAESIERLIIDGVLKVGQPLPSERRLCEKLGFSRSALREGLTVLRGRGIIETAQGRDSRVARLNRVQDTSPLIHLFSTQPRTLYDLLDVRALLEGESARLAATLGTQADFVVITRCYEKMLAASENNKEISLIEHAQLDHAFHLAICQASHNQVLVFTLQSLTDLMFNSVFASVNNLYHRPQQKKQIDRQHARIYNAVLQRLPHVAQRAARDHVRTVKKNLHDIELEGHHLIRSAVPLEMNLS
-
Molecular Weight
44.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of the glcC recombinant protein is rooted in its vital role in various biological processes, particularly in the context of microbial metabolism and environmental interactions. GlcC, or glucose-specific phosphotransferase system component C, is essential for the transport and phosphorylation of glucose in bacteria, a process crucial for energy production and carbon metabolism. Researchers are increasingly focused on the glcC gene to better understand its functionality and regulatory mechanisms, given its importance in bacterial growth and survival. The recombinant expression of glcC allows for the detailed analysis of its structure and function, enabling scientists to investigate potential applications in biotechnology, such as the development of biosensors and bioengineered microorganisms. Furthermore, elucidating the role of glcC in nutrient assimilation can provide insights into microbial ecology and the adaptation strategies of bacteria in diverse environments. As industries increasingly rely on microbial processes for sustainable production, understanding proteins like glcC becomes essential in optimizing microbial strains for improved performance and efficiency. Overall, the research surrounding glcC recombinant protein contributes significantly to the fields of microbiology, biotechnology, and genetic engineering, paving the way for innovative applications in health and environmental sustainability.











