Analytical Data
-
Gene name
TMEM27
- Application
-
Alternative Names
TMEM27；TMEM27；Collectrin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9HBJ8
-
Expression Region
1-222aa
-
AA Sequence
MLWLLFFLVTAIHAELCQPGAENAFKVRLSIRTALGDKAYAWDTNEEYLF KAMVAFSMRKVPNREATEISHVLLCNVTQRVSFWFVVTDPSKNHTLPAVE VQSAIRMNKNRINNAFFLNDQTLEFLKIPSTLAPPMDPSVPIWIIIFGVI FCIIIVAIALLILSGIWQRRRKNKEPSEVDDAEDKCENMITIENGIPSDP LDMKGGHINDAFMTEDERLTPL
-
Molecular Weight
52 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMEM27, a member of the transmembrane protein family, has garnered attention in recent years due to its potential role in various metabolic processes and diseases. Initially identified as a protein expressed in adipose tissues, TMEM27 has been implicated in the regulation of energy metabolism and insulin sensitivity. Research indicates that variations in TMEM27 expression may influence obesity and metabolic disorders, highlighting its relevance in the context of glucose homeostasis and lipid metabolism. Furthermore, recent studies suggest that TMEM27 may modulate signaling pathways associated with inflammation and cellular stress, further linking it to chronic diseases such as diabetes and cardiovascular disorders. To better understand its biological functions and therapeutic potential, researchers have begun to investigate the properties of recombinant TMEM27 protein, facilitating in-depth studies on its physiological roles and interactions within cellular systems. This research is crucial for elucidating the mechanisms by which TMEM27 contributes to metabolic regulation and for developing targeted strategies to combat metabolic diseases. Ultimately, the study of recombinant TMEM27 may pave the way for novel approaches to improve metabolic health and address related disorders.
