Cat: PA1000-6206

Recombinant Human TMEM27 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TMEM27

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TMEM27;TMEM27;Collectrin

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9HBJ8

  • Expression Region

    1-222aa

  • AA Sequence

    MLWLLFFLVTAIHAELCQPGAENAFKVRLSIRTALGDKAYAWDTNEEYLF KAMVAFSMRKVPNREATEISHVLLCNVTQRVSFWFVVTDPSKNHTLPAVE VQSAIRMNKNRINNAFFLNDQTLEFLKIPSTLAPPMDPSVPIWIIIFGVI FCIIIVAIALLILSGIWQRRRKNKEPSEVDDAEDKCENMITIENGIPSDP LDMKGGHINDAFMTEDERLTPL

  • Molecular Weight

    52 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TMEM27, a member of the transmembrane protein family, has garnered attention in recent years due to its potential role in various metabolic processes and diseases. Initially identified as a protein expressed in adipose tissues, TMEM27 has been implicated in the regulation of energy metabolism and insulin sensitivity. Research indicates that variations in TMEM27 expression may influence obesity and metabolic disorders, highlighting its relevance in the context of glucose homeostasis and lipid metabolism. Furthermore, recent studies suggest that TMEM27 may modulate signaling pathways associated with inflammation and cellular stress, further linking it to chronic diseases such as diabetes and cardiovascular disorders. To better understand its biological functions and therapeutic potential, researchers have begun to investigate the properties of recombinant TMEM27 protein, facilitating in-depth studies on its physiological roles and interactions within cellular systems. This research is crucial for elucidating the mechanisms by which TMEM27 contributes to metabolic regulation and for developing targeted strategies to combat metabolic diseases. Ultimately, the study of recombinant TMEM27 may pave the way for novel approaches to improve metabolic health and address related disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US