Analytical Data
-
Gene name
lapB
- Application
-
Alternative Names
lapB；yciM；Lipopolysaccharide assembly Protein B
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0AB58
-
Expression Region
17-389aa
-
AA Sequence
WYMGRRSAQQNKQDEANRLSRDYVAGVNFLLSNQQDKAVDLFLDMLKEDTGTVEAHLTLGNLFRSRGEVDRAIRIHQTLMESASLTYEQRLLAIQQLGRDYMAAGLYDRAEDMFNQLTDETDFRIGALQQLLQIYQATSEWQKAIDVAERLVKLGKDKQRVEIAHFYCELALQHMASDDLDRAMTLLKKGAAADKNSARVSIMMGRVFMAKGEYAKAVESLQRVISQDRELVSETLEMLQTCYQQLGKTAEWAEFLQRAVEENTGADAELMLADIIEARDGSEAAQVYITRQLQRHPTMRVFHKLMDYHLNEAEEGRAKESLMVLRDMVGEKVRSKPRYRCQKCGFTAYTLYWHCPSCRAWSTIKPIRGLDGL
-
Molecular Weight
58.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LapB is a crucial protein found in the context of bacterial biofilm formation and functions as a key player in the processes of adhesion and stability of biofilms. Recognizing the significance of biofilms in various environments, such as medical, industrial, and ecological systems, researchers have focused on understanding the molecular mechanisms underpinning biofilm development. LapB, being a part of the Lap system in bacteria, contributes to the establishment and maintenance of biofilms by mediating interactions between cells and surfaces. Its role has implications in pathogenicity, as biofilms can enhance bacterial resistance to antibiotics and evade host immune responses. Studying LapB involves exploring its structure, function, and interactions with other biomolecules and surfaces. The potential for LapB as a target for biotechnological applications, such as biofilm control and prevention strategies, emphasizes the importance of gaining deeper insights into this protein's behavior and properties. Additionally, research on LapB encompasses methodologies such as recombinant protein expression and characterization, enabling a detailed understanding of its contributions to biofilm dynamics and offering avenues for innovative solutions to combat biofilm-associated challenges in various sectors.
