Analytical Data
-
Gene name
CCDC4
- Application
-
Alternative Names
BEND4; CCDC4; BEN domain-containing Protein 4; Coiled-coil domain-containing Protein 4
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6ZU67
-
Expression Region
1-416aa
-
AA Sequence
MQGAPRARFGSRTPPAAAASSSSPSCTPATSQGHLRTPAQPPPASPAASSSSSFAAVVRYGPGAAAAAGTGGTGSDSASLELSAESRMILDAFAQQCSRVLSLLNCGGKLLDSNHSQSMISCVKQEGSSYNERQEHCHIGKGVHSQTSDNVDIEMQYMQRKQQTSAFLRVFTDSLQNYLLSGSFPTPNPSSASEYGHLADVDPLSTSPVHTLGGWTSPATSESHGHPSSSTLPEEEEEEDEEGYCPRCQELEQEVISLQQENEELRRKLESIPVPCQTVLDYLKMVLQHHNQLLIPQPADQPTEGSKQLLNNYPVYITSKQWDEAVNSSKKDGRRLLRYLIRFVFTTDELKYSCGLGKRKRSVQSGETGPERRPLDPVKVTCLRGTASFRSVSPSVISFHRIGCGSPRTSVQPSVF
-
Molecular Weight
72.71 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCDC4, or coiled-coil domain containing 4, is a protein that plays a critical role in various cellular functions, including cell differentiation, proliferation, and signaling pathways. Recent research has indicated its involvement in several biological processes and diseases, particularly in the context of cancer and neurodevelopmental disorders. CCDC4 is located on chromosome 19 and is characterized by its coiled-coil structural motifs, which facilitate protein-protein interactions. Its expression levels and functional implications have garnered significant attention in the field of molecular biology and medicine. Mutations or altered expression of CCDC4 have been observed in various types of cancer, suggesting that it may act as a tumor suppressor or an oncogene depending on the cellular context. Additionally, studies have shown its potential role in regulating cellular responses to stress and apoptosis. As researchers continue to elucidate the precise mechanisms of CCDC4 in health and disease, recombinant CCDC4 protein has become a valuable tool for further investigations. This protein can be expressed and purified for use in functional assays, structural studies, and drug discovery efforts, enhancing our understanding of its biological roles and therapeutic potential. Collectively, exploring CCDC4's functions at the molecular level could pave the way for novel therapeutic strategies targeting diseases associated with its dysregulation.
