Analytical Data
-
Gene name
RNF133
- Application
-
Alternative Names
RNF133; E3 ubiquitin-protein ligase RNF133; RING finger protein 133; RING-type E3 ubiquitin transferase RNF133
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WVZ7
-
Expression Region
1-376 aa
-
AA Sequence
MHLLKVGTWRNNTASSWLMKFSVLWLVSQNCCRASVVWMAYMNISFHVGNHVLSELGETGVFGRSSTLKRVAGVIVPPEGKIQNACNPNTIFSRSKYSETWLALIERGGCTFTQKIKVATEKGASGVIIYNVPGTGNQVFPMFHQAFEDVVVVMIGNLKGTEIFHLIKKGVLITAVVEVGRKHIIWMNHYLVSFVIVTTATLAYFIFYHIHRLCLARIQNRRWQRLTTDLQNTFGQLQLRVVKEGDEEINPNGDSCVICFERYKPNDIVRILTCKHFFHKNCIDPWILPHGTCPICKCDILKVLGIQVVVENGTEPLQVLMSNELPETLSPSEEETNNEVSPAGTSDKVIHVEENPTSQNNDIQPHSVVEDVHPSP
-
Molecular Weight
68.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RNF133, an E3 ubiquitin ligase, has garnered increasing attention in recent years due to its potential role in various biological processes and diseases. E3 ligases are crucial components of the ubiquitin-proteasome system, which regulates protein degradation and cellular homeostasis. Specifically, RNF133 is believed to be involved in the modulation of cellular signaling pathways and the maintenance of protein stability. Research suggests that RNF133 may play a significant role in cancer progression, immune response, and neurodegenerative diseases, indicating its importance as a therapeutic target. Understanding its mechanisms of action and identifying its substrates could provide insights into novel treatment strategies. Additionally, the recombinant expression of RNF133 has facilitated studies on its function and interactions in a controlled environment, making it a valuable tool for elucidating its biological roles. The exploration of RNF133’s structure and function through recombinant protein studies also opens avenues for developing inhibitors or activators, which could have profound implications in clinical settings. Overall, the study of RNF133 and its recombinant protein forms represents a promising area of research with the potential to contribute to our understanding of complex cellular mechanisms and the development of innovative therapeutic approaches.
