Cat: PA1000-5914

Recombinant Human TBG Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TBG

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TBG;TBG;Thyroxine-binding globulin

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P05543

  • Expression Region

    1-415aa

  • AA Sequence

    MSPFLYLVLLVLGLHATIHCASPEGKVTACHSSQPNATLYKMSSINADFA FNLYRRFTVETPDKNIFFSPVSISAALVMLSFGACCSTQTEIVETLGFNL TDTPMVEIQHGFQHLICSLNFPKKELELQIGNALFIGKHLKPLAKFLNDV KTLYETEVFSTDFSNISAAKQEINSHVEMQTKGKVVGLIQDLKPNTIMVL VNYIHFKAQWANPFDPSKTEDSSSFLIDKTTTVQVPMMHQMEQYYHLVDM ELNCTVLQMDYSKNALALFVLPKEGQMESVEAAMSSKTLKKWNRLLQKGW VDLFVPKFSISATYDLGATLLKMGIQHAYSENADFSGLTEDNGLKLSNAA HKAVLHIGEKGTEAAAVPEVELSDQPENTFLHPIIQIDRSFMLLILERST RSILFLGKVVNPTEA

  • Molecular Weight

    73 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The research on TBG (Thyroxine-Binding Globulin) recombinant proteins is rooted in the need to understand and manipulate thyroid hormone transport and metabolism in the human body. TBG is a crucial plasma protein responsible for binding and transporting thyroxine (T4) and triiodothyronine (T3), which are essential hormones regulating metabolism, growth, and development. Abnormal levels of TBG can lead to thyroid disorders, including hypothyroidism and hyperthyroidism, making its study significant for clinical diagnostics and therapies. The advent of recombinant DNA technology has enabled the production of TBG in the laboratory, allowing for better characterization of its structure and function, as well as the investigation of genetic variants associated with thyroid hormone transport disorders. Furthermore, recombinant TBG can serve as a valuable tool in research and therapeutic applications, including the development of hormone replacement therapies and the study of drug interactions that influence thyroid hormone levels. By focusing on TBG, researchers aim to enhance understanding of thyroid health and develop novel approaches for managing thyroid-related diseases, ultimately contributing to improved patient outcomes in endocrinology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US