Analytical Data
-
Gene name
CCDC126
- Application
-
Alternative Names
CCDC126; UNQ786/PRO1605; Coiled-coil domain-containing Protein 126
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96EE4
-
Expression Region
1-140aa
-
AA Sequence
MFFTISRKNMSQKLSLLLLVFGLIWGLMLLHYTFQQPRHQSSVKLREQILDLSKRYVKALAEENKNTVDVENGASMAGYADLKRTIAVLLDDILQRLVKLENKVDYIVVNGSAANTTNGTSGNLVPVTTNKRTNVSGSIR
-
Molecular Weight
42.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCDC126, also known as Coiled-coil domain-containing protein 126, is a protein that has garnered interest in the field of cell biology and genetics due to its potential roles in cellular processes and human health. Research has indicated that CCDC126 is involved in the regulation of cilia formation and function, which are crucial for various signaling pathways and cellular communication. Disruptions in cilia function have been linked to a range of diseases, including developmental disorders, cancer, and ciliopathies. The study of CCDC126, particularly through the expression of recombinant proteins, enables scientists to delve into its structure-function relationship and elucidate its biological mechanisms. By producing a recombinant form of CCDC126, researchers can perform in vitro studies that contribute to understanding how this protein interacts with other cellular components and its role in ciliary dynamics. Furthermore, the insights gained from CCDC126 research may lead to novel therapeutic approaches for diseases associated with ciliary dysfunction. Overall, the exploration of CCDC126 and its recombinant forms represents a significant step toward uncovering the molecular underpinnings of critical biological processes and their implications for human health.
