Analytical Data
-
Gene name
toxR
- Application
-
Alternative Names
toxR;Cholera toxin homolog transcriptional activator
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P09852
-
Expression Region
1-259aa
-
AA Sequence
MTATDRTPPPLKWLCLGNRDANDGFELFAHGIYARNGALVGSKLSLRERRQRVDLSAFLSGAPPLLAEAAVKHLLARLLCVHRHNTDLELLGKNFIPLHASSLGNAGVCERILASARQLQQHQVELCLLLAIDEQEPASAEYLTSLARLRDSGVRIALHPQRIDTDARQCFAEVDAGLCDYLGLDARLLAPGPLTRNLRQRKSIEYLNRLLVAQDIQMLCLNVDNEELHQQANALPFAFRHGRHYSEPFQAWPFSSPAC
-
Molecular Weight
32.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ToxR is a well-studied transmembrane protein associated with the pathogenesis of enterotoxigenic Escherichia coli (ETEC). This protein acts as a transcriptional regulator, modulating the expression of virulence factors essential for the bacteria's adherence and colonization in the host's intestinal environment. The ToxR system plays a crucial role in the pathogenicity of ETEC by sensing environmental cues and responding to them, which allows the bacteria to adapt to changes in the gut microenvironment. The importance of ToxR is underscored by its involvement in the regulation of genes responsible for producing heat-stable enterotoxins (ST) and adhesins like adhesion A (AIDA), which are vital for establishing infection. Research into ToxR not only enhances our understanding of bacterial pathogenic mechanisms but also provides potential avenues for therapeutic interventions and vaccine development against ETEC infections. The recombinant expression of ToxR in various systems can elucidate its structural and functional properties, paving the way for advancements in combating ETEC-related diseases. Understanding the interaction of ToxR with other cellular components and its regulatory networks further highlights its significance in microbial pathogenicity and offers insights into developing novel strategies for managing bacterial infections.











