Cat: PA2000-2726

Recombinant E.coli mecA Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    mecA

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    mecA;Pv1;Plasmalemma vesicle-associated Protein

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P60186

  • Expression Region

    1-239aa

  • AA Sequence

    MRIERVDDTTVKLFITYSDIEARGFSREDLWTNRKRGEEFFWSMMDEINEEEDFVVEGPLWIQVHAFEKGVEVTISKSKNEDMMNMSDDDATDQFDEQVQELLAQTLEGEDQLEELFEQRTKEKEAQGSKRQKSSARKNTRTIIVKFNDLEDVINYAYHSNPITTEFEDLLYMVDGTYYYAVHFDSHVDQEVINDSYSQLLEFAYPTDRTEVYLNDYAKIIMSHNVTAQVRRYFPETTE

  • Molecular Weight

    44.3 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The mecA gene, a critical determinant of methicillin resistance in Staphylococcus aureus, encodes for the penicillin-binding protein PBP2a, which confers resistance to beta-lactam antibiotics. This makes it a significant target for studying antibiotic resistance in pathogenic bacteria. The emergence of methicillin-resistant Staphylococcus aureus (MRSA) represents a major public health challenge, as infections caused by these strains are associated with increased morbidity, mortality, and healthcare costs. Research on recombinant mecA protein focuses on understanding the mechanisms of resistance at the molecular level, exploring its structure and function, and developing potential therapeutics and diagnostic tools. By expressing and purifying the mecA-encoded protein, scientists aim to elucidate its role in cell wall synthesis and resistance mechanisms. Additionally, this research helps assess the efficacy of novel antimicrobial agents and promotes the development of alternative strategies to combat MRSA infections, such as vaccines or inhibitors targeting PBP2a. The insights gained from mecA studies are crucial for informing clinical treatment protocols and developing strategies to mitigate the spread of antibiotic resistance in S. aureus and other pathogens. As antibiotic resistance continues to escalate, the exploration of mecA and its recombinant products remains a vital area of investigation in microbiological and pharmaceutical research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US