Analytical Data
-
Gene name
mecA
- Application
-
Alternative Names
mecA；Pv1；Plasmalemma vesicle-associated Protein
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P60186
-
Expression Region
1-239aa
-
AA Sequence
MRIERVDDTTVKLFITYSDIEARGFSREDLWTNRKRGEEFFWSMMDEINEEEDFVVEGPLWIQVHAFEKGVEVTISKSKNEDMMNMSDDDATDQFDEQVQELLAQTLEGEDQLEELFEQRTKEKEAQGSKRQKSSARKNTRTIIVKFNDLEDVINYAYHSNPITTEFEDLLYMVDGTYYYAVHFDSHVDQEVINDSYSQLLEFAYPTDRTEVYLNDYAKIIMSHNVTAQVRRYFPETTE
-
Molecular Weight
44.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The mecA gene, a critical determinant of methicillin resistance in Staphylococcus aureus, encodes for the penicillin-binding protein PBP2a, which confers resistance to beta-lactam antibiotics. This makes it a significant target for studying antibiotic resistance in pathogenic bacteria. The emergence of methicillin-resistant Staphylococcus aureus (MRSA) represents a major public health challenge, as infections caused by these strains are associated with increased morbidity, mortality, and healthcare costs. Research on recombinant mecA protein focuses on understanding the mechanisms of resistance at the molecular level, exploring its structure and function, and developing potential therapeutics and diagnostic tools. By expressing and purifying the mecA-encoded protein, scientists aim to elucidate its role in cell wall synthesis and resistance mechanisms. Additionally, this research helps assess the efficacy of novel antimicrobial agents and promotes the development of alternative strategies to combat MRSA infections, such as vaccines or inhibitors targeting PBP2a. The insights gained from mecA studies are crucial for informing clinical treatment protocols and developing strategies to mitigate the spread of antibiotic resistance in S. aureus and other pathogens. As antibiotic resistance continues to escalate, the exploration of mecA and its recombinant products remains a vital area of investigation in microbiological and pharmaceutical research.
