Analytical Data
-
Gene name
ALKAL1
- Application
-
Alternative Names
ALKAL1；FAM150A；ALK and LTK ligand 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6UXT8
-
Expression Region
28-129aa
-
AA Sequence
RPRGRRGARVTDKEPKPLLFLPAAGAGRTPSGSRSAEIFPRDSNLKDKFIKHFTGPVTFSPECSKHFHRLYYNTRECSTPAYYKRCARLLTRLAVSPLCSQT
-
Molecular Weight
25.5kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ALKAL1 (Alkaline Phosphatase-Like Protein 1) is a member of the alkaline phosphatase family, which plays a crucial role in various biological processes, including bone mineralization, dephosphorylation of molecules, and regulation of cellular signaling pathways. The study of ALKAL1 has garnered interest due to its potential involvement in metabolic disorders and its unique expression patterns in different tissues. Research indicates that ALKAL1 may be implicated in physiological processes such as development and immune responses, making it a candidate for further investigation in the context of various diseases. Understanding its structure and function at the molecular level can provide insights into its role and mechanisms of action, paving the way for potential therapeutic applications. Recent advances in recombinant protein technology have enabled the production of ALKAL1 in significant quantities, facilitating detailed studies on its enzymatic activity, substrate specificity, and structural characteristics. This research is vital for elucidating the biological significance of ALKAL1 and exploring its potential as a biomarker or therapeutic target in related pathological conditions.
