Analytical Data
-
Gene name
hfb1
- Application
-
Alternative Names
hfb1；Hydrophobin-1
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P52754
-
Expression Region
23-97aa
-
AA Sequence
SNGNGNVCPPGLFSNPQCCATQVLGLIGLDCKVPSQNVYDGTDFRNVCAKTGAQPLCCVAPVAGQALLCQTAVGA
-
Molecular Weight
23.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HFB1, or Hypothetical protein HFB1, is a recombinant protein that has garnered attention in various fields of biomedical research. Emerging from the study of plant defense mechanisms, specifically in response to pathogen attacks, HFB1 is believed to play a role in the plant's ability to mitigate stress and enhance resistance to diseases. Characterizing HFB1 has implications for agricultural biotechnology, particularly in developing crops that can withstand environmental stresses such as drought or pathogens. Researchers aim to understand its structure, function, and potential applications in bioengineering. Through recombinant DNA technology, HFB1 can be expressed in various host systems, enabling scientists to dissect its properties, including its biochemical interactions and molecular mechanisms. Studies have shown that modulating the expression of HFB1 can lead to improved stress tolerance in plants, making it a candidate for enhancing crop yields in changing climates. Furthermore, research into HFB1 contributes to the broader understanding of plant biology and may pave the way for novel agricultural solutions. The exploration of HFB1 and similar proteins reflects an increasing emphasis on sustainable agricultural practices and the potential for using advanced biotechnological approaches to address food security challenges globally.
