Analytical Data
-
Gene name
CALCRL
- Application
-
Alternative Names
CALCRL; CGRPR; Calcitonin gene-related peptide type 1 receptor; CGRP type 1 receptor; Calcitonin receptor-like receptor
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q16602
-
Expression Region
23-132aa
-
AA Sequence
ELEESPEDSIQLGVTRNKIMTAQYECYQKIMQDPIQQAEGVYCNRTWDGWLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRTWTNYTQCNVNTH
-
Molecular Weight
37.84 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CALCRL (Calcitonin Receptor-Like Receptor) is a G protein-coupled receptor (GPCR) that has garnered significant attention in recent years due to its crucial role in various physiological processes, including pain modulation, cardiovascular functions, and metabolism. This receptor primarily interacts with neuropeptides such as calcitonin gene-related peptide (CGRP), which is involved in vasodilation and nociceptive signaling. Given the increasing prevalence of chronic pain and cardiovascular diseases worldwide, understanding the signaling pathways and functional mechanisms associated with CALCRL has become essential. Researchers have focused on the development of recombinant CALCRL proteins to elucidate its structure-function relationships and to explore potential therapeutic applications. The production of recombinant proteins allows for the detailed study of CALCRL's binding affinity to its ligands, downstream signaling pathways, and interaction with other cellular components. Moreover, findings from CALCRL studies may lead to the design of novel drugs that target this receptor, providing new avenues for treating conditions such as migraines, hypertension, and other disorders linked to CGRP signaling. Through advanced biophysical and biochemical techniques, the characterization of CALCRL and its role in health and disease continues to be a promising area of research, aiming to contribute to healthier therapeutic options in modern medicine.
