Analytical Data
-
Gene name
CSRP1
- Application
-
Alternative Names
CSRP1；CSRP；CYRP；Cysteine and glycine-rich Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P21291
-
Expression Region
1-193aa
-
AA Sequence
MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVA VHGEEIYCKSCYGKKYGPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRP TTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCG KGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE
-
Molecular Weight
47 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CSRP1 (Cysteine and Serine-Rich Protein 1) is a crucial member of the cysteine-rich protein family and plays significant roles in cellular processes such as muscle differentiation, cell growth, and signal transduction. Research has shown that CSRP1 is involved in various physiological and pathological conditions, including cardiac development and heart disease, as well as some forms of cancer. Its expression levels and post-translational modifications can greatly influence cellular behavior, making it an important target for understanding disease mechanisms. Recent studies have focused on the functional characterization of CSRP1, particularly through the use of recombinant proteins, which allow for detailed investigations into its structure-function relationships and interactions with other cellular proteins. The ability to produce CSRP1 in a recombinant system enables researchers to explore its biochemical properties and potential as a therapeutic target. Given the emerging evidence linking CSRP1 to critical signaling pathways and disease processes, the study of its recombinant form could provide insights into novel therapeutic interventions, thus highlighting the importance of CSRP1 research in the broader context of cell biology and medical science. Overall, CSRP1 serves as a potential biomarker and therapeutic target, making it a compelling subject of investigation for researchers aiming to develop strategies for treating cardiovascular diseases and other conditions associated with dysregulated CSRP1 function.
