Analytical Data
-
Gene name
NPC1
- Application
-
Alternative Names
NPC1；NPC intracellular cholesterol transporter 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15118
-
Expression Region
151-250aa
-
AA Sequence
GFANAMYNACRDVEAPSSNDKALGLLCGKDADACNATNWIEYMFNKDNGQ APFTITPVFSDFPVHGMEPMNNATKGCDESVDEVTAPCSCQDCSIVCGPK
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Niemann-Pick C1-like 1 protein (NPC1) is a crucial membrane protein primarily known for its role in cholesterol and lipid transport within the endosomal-lysosomal pathway. Mutations in the NPC1 gene are linked to Niemann-Pick disease type C, a severe neurodegenerative disorder characterized by cholesterol accumulation in various tissues, particularly the brain. Research into NPC1 has gained momentum due to its significant implications in cellular lipid homeostasis, disease progression, and potential therapeutic avenues. The recombinant expression of NPC1 protein allows for detailed structural and functional studies, which are essential for understanding its mechanisms and interactions at a molecular level. Additionally, NPC1 has garnered attention in the context of viral infections, including its involvement in the entry of several pathogens, making it a potential target for antiviral strategies. By generating and characterizing NPC1 recombinant proteins, researchers aim to elucidate its role in lipid metabolism, develop effective treatment options for Niemann-Pick disease, and investigate its relevance in infectious disease contexts, thereby contributing to a broader understanding of lipid biology and disease mechanisms.
