Analytical Data
-
Gene name
C7orf46
- Application
-
Alternative Names
FAM221A; C7orf46Protein FAM221A
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A4D161
-
Expression Region
1-298aa
-
AA Sequence
MERLTLPLGGAAAVDEYLEHRRIVGEDDGGKLFTPEEYEEYKRKVLPLRLQNRLFVSWRSPTGMDCKLVGPETLCFCTHRYKQHKTDLEAIPQQCPIDLPCQVTGCQCRAYLYVPLNGSQPIRCRCKRFADQHSAAPGFTCNTCSKCSGFHSCFTCACGQPAYAHDTVVETKQERLAQEKPVGQDIPYAAMGGLTGFSSLAEGYMRLDDSGIGVPSVEFLESPITAVDSPFLKAFQASSSSSPETLTDVGTSSQVSSLRRPEEDDMAFFERRYQERMKMEKAAKWKGKAPLPSATKPS
-
Molecular Weight
59.5 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C7orf46, also known as chromosome 7 open reading frame 46, is a relatively uncharacterized protein that has garnered attention in recent years due to its potential roles in cellular processes and disease mechanisms. While its functions remain largely elusive, preliminary studies suggest that C7orf46 may be involved in critical pathways related to cell proliferation, differentiation, and apoptosis. Research indicates that it could play a role in various biological contexts, including immune response and cancer progression. The protein is located on chromosome 7, a region that has been linked to several genetic disorders and malignancies, raising interest in its potential implications in human health. Recombinant protein technology has enabled researchers to produce C7orf46 in vitro, facilitating detailed biochemical studies and functional assays. By generating and characterizing recombinant C7orf46, scientists aim to elucidate its structure-function relationships and interactions with other biomolecules, which could uncover its biological roles and identify potential therapeutic targets. Given the increasing evidence linking C7orf46 with significant health issues, research into this protein is expected to expand, contributing to a deeper understanding of its relevance in physiology and pathology.
