Analytical Data
-
Gene name
PPX1
- Application
-
Alternative Names
PPX1；EP124；EP129；Serine/threonine-Protein phosphatase PP-X isozyme 1
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P38698
-
Expression Region
1-397aa
-
AA Sequence
MSPLRKTVPEFLAHLKSLPISKIASNDVLTICVGNESADMDSIASAITYSYCQYIYNEGTYSEEKKKGSFIVPIIDIPREDLSLRRDVMYVLEKLKIKEEELFFIEDLKSLKQNVSQGTELNSYLVDNNDTPKNLKNYIDNVVGIIDHHFDLQKHLDAEPRIVKVSGSCSSLVFNYWYEKLQGDREVVMNIAPLLMGAILIDTSNMRRKVEESDKLAIERCQAVLSGAVNEVSAQGLEDSSEFYKEIKSRKNDIKGFSVSDILKKDYKQFNFQGKGHKGLEIGLSSIVKRMSWLFNEHGGEADFVNQCRRFQAERGLDVLVLLTSWRKAGDSHRELVILGDSNVVRELIERVSDKLQLQLFGGNLDGGVAMFKQLNVEATRKQVVPYLEEAYSNLEE
-
Molecular Weight
49.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PPX1 (Polyphosphate 1) is a distinctive exopolyphosphatase enzyme that plays a crucial role in the metabolism of inorganic polyphosphates in various organisms, including bacteria, yeast, and mammals. Its primary function is to hydrolyze long-chain polyphosphates into shorter chains, thereby regulating the cellular levels of these polyphosphates, which are essential for a range of biological processes, such as energy metabolism, signaling, and stress responses. The study of PPX1 became critical as researchers began to uncover its significance in cellular homeostasis and pathophysiological conditions. Dysregulation of polyphosphate metabolism, associated with PPX1 activity, has been linked to several diseases, including cancer and cardiovascular disorders, leading to increased interest in this enzyme as a potential therapeutic target. Additionally, the development of recombinant PPX1 protein has facilitated deeper investigations into its structural and functional properties, enabling scientists to explore its enzymatic mechanisms and interactions. Such research not only provides insights into fundamental biological processes but also opens avenues for biomedical applications, where modulating PPX1 activity could yield novel strategies for disease intervention. Overall, the study of PPX1 recombinant protein is integral to understanding its biological roles and developing innovative therapeutic approaches in treating polyphosphate-related diseases.
