Analytical Data
-
Gene name
RARRES3
- Application
-
Alternative Names
HRASLS4; MGC8906; RAR responsive protein TIG3; RAR-responsive protein TIG3; RARRES3; Retinic acid inducible gene 1; Retinoic acid receptor responder (tazarotene induced) 3; Retinoic acid receptor responder protein 3; Retinoid inducible gene 1 protein; Retinoid-inducible gene 1 protein; RIG 1; rig1; Tazarotene induced gene 3 protein; Tazarotene-induced gene 3 protein; TIG 3; TIG3; TIG3_HUMAN
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UL19
-
Expression Region
1-164 aa
-
AA Sequence
MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQLRYGKSRCKQVEKAKVEVGVATALGILVVAGCSFAIRRYQKKATA
-
Molecular Weight
43.78 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RARRES3, also known as retinoic acid receptor responder protein 3, is a member of the retinoic acid receptor (RAR) signaling pathway and has garnered considerable interest in the field of molecular biology and cancer research. It was originally identified as a gene upregulated by retinoic acid and has since been implicated in various physiological processes, including cell differentiation, proliferation, and apoptosis. Studies have shown that RARRES3 exhibits anti-tumorigenic properties, suggesting a potential role as a tumor suppressor. Its differential expression in various cancers, including breast, prostate, and colorectal cancer, has led to investigations into its potential as a biomarker for diagnosis and prognosis. The research on RARRES3 also explores its molecular mechanisms, such as interactions with other signaling pathways and its influence on gene expression profiles. Moreover, understanding the functional role of RARRES3 in cellular contexts may open new avenues for therapeutic strategies targeting cancer and other diseases. As a recombinant protein, RARRES3 is of particular interest for experimental applications, allowing researchers to study its biochemical properties and interactions in controlled settings. Further insights into RARRES3 could significantly enhance our understanding of its biological functions and clinical relevance, ultimately contributing to the development of innovative diagnostic and therapeutic tools.
