Analytical Data
-
Gene name
vpx
- Application
-
Alternative Names
vpx；KIAA0800；RIP；VPRBP；DDB1- and CUL4-associated factor 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P06939
-
Expression Region
1-112aa
-
AA Sequence
MTDPRETVPPGNSGEETIGEAFAWLNRTVEAINREAVNHLPRELIFQVWQ RSWRYWHDEQGMSESYTKYRYLCIIQKAVYMHVRKGCTCLGRGHGPGGWR PGPPPPPPPGLV
-
Molecular Weight
12.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
VPX protein, derived from the human immunodeficiency virus type 1 (HIV-1), plays a crucial role in the virus's life cycle by facilitating reverse transcription and enhancing viral replication. Research on VPX has gained traction due to its unique ability to evade host immune responses and its involvement in the degradation of the host's antiviral protein, APOBEC3, which typically restricts retroviral infections. Given the increasing global prevalence of HIV and the ongoing need for effective therapies, VPX has become a focal point in virology studies aimed at understanding viral pathogenesis and exploring novel therapeutic approaches. Additionally, VPX's potential utility in other fields, such as vaccine development and gene therapy, has spurred interest in its structural and functional properties. The investigation of VPX involves advanced techniques, including protein expression systems, crystallography, and cellular assays, to elucidate its mechanisms of action. Overall, research on VPX not only contributes to our comprehension of HIV pathogenesis but also opens avenues for the development of innovative biotechnological applications.
