Analytical Data
-
Gene name
ACT1
- Application
-
Alternative Names
ACT1；AAC1；Actin-1
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P60010
-
Expression Region
1-375aa
-
AA Sequence
MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF
-
Molecular Weight
49.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ACT1 is a crucial protein that plays a significant role in the immune response and inflammation processes. Characterized as an adaptor protein, ACT1 interacts with various signaling molecules and pathways, particularly in the context of Toll-like receptor (TLR) and interleukin receptor (ILR) signaling. Its involvement in cellular responses to pathogens and the regulation of inflammatory cytokines has made it a focal point of research in immunology. Dysregulation of ACT1 has been linked to several autoimmune diseases and conditions, highlighting its importance in maintaining immune homeostasis. The ability to produce and study recombinant ACT1 protein allows researchers to investigate its structure, function, and interactions in detail, contributing to our understanding of its role in both normal immune functions and pathogenic processes. This research not only aids in deciphering the complex mechanisms of immune signaling but also opens avenues for potential therapeutic interventions in diseases where ACT1-mediated pathways are implicated. Thus, the study of ACT1 recombinant protein is vital for advancing our knowledge of immune system regulation and the development of targeted treatments for inflammatory and autoimmune disorders.
