Analytical Data
-
Gene name
C2orf76
- Application
-
Alternative Names
AIM29; C2orf76; CB076_HUMAN; Chromosome 2 open reading frame 76; UPF0538 Protein C2orf76
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q3KRA6
-
Expression Region
1-126aa
-
AA Sequence
MAPGEVTITVRLIRSFEHRNFKPVVYHGVNLDQTVKEFIVFLKQDIPLRTNLPPPFRNYKYDALKIIHQAHKSKTNELVLSLEDDERLLLKEDSTLKAAGIASETEIAFFCEEDYKNYKANPISSW
-
Molecular Weight
13.9 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C2orf76, also known as chromosome 2 open reading frame 76, is a gene that has garnered interest due to its potential implications in various biological processes and diseases. This protein is located on chromosome 2 and is thought to play a role in cellular function, although its exact biological functions and mechanisms remain largely unclear. Recent studies have shown that C2orf76 may be involved in processes such as cell differentiation, proliferation, and apoptosis, which are critical in both development and disease pathology. Its expression patterns have been linked to certain cancers, indicating a potential role in tumorigenesis and progression. Consequently, the recombinant protein of C2orf76 is being explored for its structural and functional characteristics to better understand its biological role. Research involving C2orf76 recombinant protein aims to elucidate its interactions with other cellular proteins and pathways, thereby providing insights that could lead to novel therapeutic strategies for diseases associated with its dysregulation. As investigations progresses, the characterization of C2orf76 recombinant protein may reveal its potential as a biomarker for disease diagnosis and prognosis, as well as a target for new drug development. Overall, research on C2orf76 presents a promising frontier with significant implications for understanding related diseases and enhancing therapeutic options.
