Analytical Data
-
Gene name
PGA5
- Application
-
Alternative Names
PGA5；Pepsin A-5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0DJD9
-
Expression Region
63-388aa
-
AA Sequence
VDEQPLENYLDMEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNRFNPEDSSTYQSTSETVSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISSSGATPVFDNIWNQGLVSQDLFSVYLSADDKSGSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNGETIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASENSDGDMVVSCSAISSLPDIVFTINGVQYPVPPSAYILQSEGSCISGFQGMNVPTESGELWILGDVFIRQYFTVFDRANNQVGLAPVA
-
Molecular Weight
41.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PGA5 is a member of the polygalacturonase (PG) family, which plays a critical role in the degradation of pectin, a major component of plant cell walls. Understanding PGA5 is particularly important in the context of both plant biology and agricultural applications. In plants, polygalacturonases are involved in various physiological processes, including fruit ripening, cell wall remodeling, and pathogen defense, highlighting their significance in plant development and stress responses. In agriculture, enzymes like PGA5 can be utilized in biotechnology for improving fruit quality, enhancing yield, and developing disease-resistant crop varieties. Additionally, PGA5 has implications in industrial applications, such as the food industry for fruit juice clarification and pectin modification. Research into the structure, function, and regulation of PGA5 helps elucidate its mechanistic roles in plant biology and offers insights for biotechnological advancements aimed at sustainable agricultural practices. As the demand for efficient and environmentally friendly agricultural methods increases, studying PGA5 and its associated pathways may provide critical solutions for crop improvement and resilience against biotic and abiotic stressors.
