Cat: PA2000-6236

Recombinant Human C2orf7 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    C2orf7

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    C2orf7; hPAP21; MGC13004; PADC1_HUMAN; PAP21; Pradc1; Protease associated domain containing 1; Protease-associated domain-containing Protein 1; Protease-associated domain-containing Protein of 21 kDa

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BSG0

  • Expression Region

    1-188aa

  • AA Sequence

    MVPGAAGWCCLVLWLPACVAAHGFRIHDYLYFQVLSPGDIRYIFTATPAKDFGGIFHTRYEQIHLVPAEPPEACGELSNGFFIQDQIALVERGGCSFLSKTRVVQEHGGRAVIISDNAVDNDSFYVEMIQDSTQRTADIPALFLLGRDGYMIRRSLEQHGLPWAIISIPVNVTSIPTFELLQPPWTFW

  • Molecular Weight

    47.4 KDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

C2orf7, also known as the chromosome 2 open-reading frame 7, is a gene located on chromosome 2 that has garnered interest due to its potential implications in various biological processes and diseases. Initially identified through genome sequencing, C2orf7 is believed to play a role in cellular functions, although its exact biological function remains largely elusive. Recent studies have suggested that C2orf7 may be involved in important cellular processes such as cell proliferation, differentiation, and apoptosis. Moreover, emerging research indicates that alterations in C2orf7 expression could be linked to several pathological conditions, including cancer and neurological disorders. To better understand its functional roles, researchers are increasingly focusing on generating and studying recombinant C2orf7 proteins. This approach allows for the examination of the protein's structural characteristics, interactions with other biomolecules, and the mechanisms by which it may influence cellular pathways. Understanding the properties and functions of the recombinant C2orf7 protein could provide valuable insights into its role in health and disease, paving the way for potential therapeutic applications or novel biomarkers. As research progresses, elucidating the molecular functions and interactions of C2orf7 may have significant implications for enhancing our understanding of complex biological systems and developing targeted strategies for addressing diseases associated with its dysregulation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US