Analytical Data
-
Gene name
MSH6
- Application
-
Alternative Names
MSH6；GTBP；DNA mismatch repair Protein Msh6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P52701
-
Expression Region
931-1030aa
-
AA Sequence
AGFDSDYDQALADIRENEQSLLEYLEKQRNRIGCRTIVYWGIGRNRYQLE IPENFTTRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDVSLK
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MSH6, a key component of the DNA mismatch repair (MMR) system, plays a crucial role in maintaining genomic stability by correcting base-pairing errors during DNA replication. Mutations in the MSH6 gene are associated with an increased risk of various cancers, particularly Lynch syndrome, which is characterized by inherited predisposition to colorectal and other types of cancer. The study of MSH6 recombinant proteins has gained significant attention as it provides insights into the functionality and mechanisms underlying MMR processes. By expressing and purifying recombinant MSH6 proteins, researchers can investigate their structural properties, binding affinities, and interactions with other MMR components. Furthermore, understanding the functional consequences of specific mutations in MSH6 through recombinant protein studies can illuminate the molecular basis of cancer predisposition and guide the development of targeted therapies. This research holds promise for advancing our knowledge of cancer biology and improving diagnostic and therapeutic strategies for patients with MMR-related cancers.
