Analytical Data
-
Gene name
MRPS22
- Application
-
Alternative Names
MRPS22;C3orf5;RPMS22;Small ribosomal subunit Protein mS22
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P82650
-
Expression Region
1-360aa
-
AA Sequence
MAPLGTTVLLWSLLRSSPGVERVCFRARIQPWHGGLLQPLPCSFEMGLPRRRFSSEAAESGSPETKKPTFMDEEVQSILTKMTGLNLQKTFKPAIQELKPPTYKLMTQAQLEEATRQAVEAAKVRLKMPPVLEERVPINDVLAEDKILEGTETTKYVFTDISYSIPHRERFIVVREPSGTLRKASWEERDRMIQVYFPKEGRKILTPIIFKEENLRTMYSQDRHVDVLNLCFAQFEPDSTEYIKVHHKTYEDIDKRGKYDLLRSTRYFGGMVWYFVNNKKIDGLLIDQIQRDLIDDATNLVQLYHVLHPDGQSAQGAKDQAAEGINLIKVFAKTEAQKGAYIELTLQTYQEALSRHSAAS
-
Molecular Weight
68.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MRPS22, a mitochondrial ribosomal protein, plays a crucial role in the protein synthesis machinery of mitochondria, which is vital for cellular energy production and overall metabolism. Recent studies have shown that mutations or dysregulation of MRPS22 can lead to various mitochondrial disorders, impacting numerous cellular functions and contributing to the pathogenesis of diseases such as neurodegenerative disorders and cancer. The increasing recognition of mitochondrial dysfunction in a wide array of diseases emphasizes the importance of understanding the precise role of MRPS22 in mitochondrial biogenesis and function. Moreover, MRPS22 is involved in the assembly and stability of the mitochondrial ribosome, making it essential for mitochondrial protein translation. As researchers strive to uncover the molecular mechanisms underlying mitochondrial diseases, the characterization of MRPS22 and its interactions with other mitochondrial components has become a focal point. Recombinant MRPS22 protein studies can provide critical insights into its functional properties, enabling the exploration of its potential as a therapeutic target or biomarker for mitochondrial-related ailments. Additionally, understanding the structural and functional dynamics of MRPS22 through recombinant approaches opens avenues for innovative research in the field of mitochondrial biology, paving the way for new strategies in disease prevention and treatment.











