Analytical Data
-
Gene name
MRPL55
- Application
-
Alternative Names
MRPL55；Large ribosomal subunit Protein mL55
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7Z7F7
-
Expression Region
34-128aa
-
AA Sequence
DSSRASLTRVHRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMPIDLDTLSPEERRARLRKREAQLQSRKEYEQELSDDLHVERYRQFWTRTKK
-
Molecular Weight
38.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MRPL55, or mitochondrial ribosomal protein L55, has emerged as a significant focus in molecular biology research due to its crucial role in mitochondrial biogenesis and function. Mitochondria are essential organelles responsible for energy production through oxidative phosphorylation, and their dysfunction is linked to various diseases, including neurodegenerative disorders and metabolic syndromes. MRPL55 is involved in assembling the mitochondrial ribosome, which is vital for synthesizing proteins encoded by the mitochondrial genome. Recent studies have suggested that alterations in MRPL55 expression may correlate with certain pathologies, indicating its potential as a biomarker or therapeutic target. Research on the recombinant form of MRPL55 aims to elucidate its structural and functional properties, facilitating a deeper understanding of mitochondrial dynamics and their implications in human health. Furthermore, the development of MRPL55 recombinant proteins can aid in high-throughput screening for drug candidates that target mitochondrial dysfunction. Given the increasing incidence of mitochondrial-related diseases, investigating MRPL55 within the context of modern biotechnology is essential for developing novel therapeutic strategies that can address these challenging health issues.
