Cat: PA2000-2102

Recombinant Human MRPL55 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MRPL55

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MRPL55;Large ribosomal subunit Protein mL55

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q7Z7F7

  • Expression Region

    34-128aa

  • AA Sequence

    DSSRASLTRVHRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMPIDLDTLSPEERRARLRKREAQLQSRKEYEQELSDDLHVERYRQFWTRTKK

  • Molecular Weight

    38.6 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MRPL55, or mitochondrial ribosomal protein L55, has emerged as a significant focus in molecular biology research due to its crucial role in mitochondrial biogenesis and function. Mitochondria are essential organelles responsible for energy production through oxidative phosphorylation, and their dysfunction is linked to various diseases, including neurodegenerative disorders and metabolic syndromes. MRPL55 is involved in assembling the mitochondrial ribosome, which is vital for synthesizing proteins encoded by the mitochondrial genome. Recent studies have suggested that alterations in MRPL55 expression may correlate with certain pathologies, indicating its potential as a biomarker or therapeutic target. Research on the recombinant form of MRPL55 aims to elucidate its structural and functional properties, facilitating a deeper understanding of mitochondrial dynamics and their implications in human health. Furthermore, the development of MRPL55 recombinant proteins can aid in high-throughput screening for drug candidates that target mitochondrial dysfunction. Given the increasing incidence of mitochondrial-related diseases, investigating MRPL55 within the context of modern biotechnology is essential for developing novel therapeutic strategies that can address these challenging health issues.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US