Cat: PA1000-4947

Recombinant Human IDH1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IDH1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IDH1;PICD;Isocitrate dehydrogenase [NADP] cytoplasmic

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O75874

  • Expression Region

    1-414aa

  • AA Sequence

    MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRD ATNDQVTKDAAEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIR NILGGTVFREAIICKNIPRLVSGWVKPIIIGHHAYGDQYRATDFVVPGPG KVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMA LSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFEAQKIWYEHRL IDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDG KTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNK ELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDK LGENLKIKLAQAKLDYKDDDDK

  • Molecular Weight

    48 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

IDH1 (isocitrate dehydrogenase 1) is an enzyme critically involved in the citric acid cycle, responsible for converting isocitrate to alpha-ketoglutarate while reducing NADP+ to NADPH. Mutations in the IDH1 gene are frequently associated with various cancers, particularly gliomas and acute myeloid leukemia (AML), leading to the production of the oncometabolite 2-hydroxyglutarate (2-HG). This metabolic shift alters cellular differentiation pathways and contributes to tumorigenesis. The study of IDH1 recombinant proteins has gained significant attention due to their dual role as potential biomarkers for cancer diagnosis and as targets for therapeutic intervention. Understanding the structural and functional properties of mutant IDH1 enzymes can help elucidate their role in carcinogenesis and support the development of small molecules that inhibit their activity or mitigate the effects of 2-HG accumulation. Recent advances in biochemistry and structural biology have facilitated the production of recombinant IDH1 proteins, enabling detailed studies of their enzymatic mechanisms, interactions with inhibitors, and implications in cancer metabolism. This research not only enhances our understanding of IDH1's pathological functions but also lays the groundwork for the design of novel therapeutic strategies aimed at targeting IDH1 mutations in cancer treatment.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US