Cat: PA2000-2104

Recombinant Human MRPS6 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MRPS6

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MRPS6;C21orf101;RPMS6;Small ribosomal subunit Protein bS6m

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P82932

  • Expression Region

    1-125aa

  • AA Sequence

    PRYELALILKAMQRPETAATLKRTIEALMDRGAIVRDLENLGERALPYRISAHSQQHNRGGYFLVDFYAPTAAVESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRKK

  • Molecular Weight

    41.1 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MRPS6, or mitochondrial ribosomal protein S6, is a vital component of the mitochondrial ribosome, playing a crucial role in the protein synthesis within mitochondria. With the increasing understanding of mitochondrial dysfunction in various diseases, including neurodegenerative disorders and cancer, MRPS6 has garnered attention for its potential implications in these conditions. Studies have highlighted its involvement in the regulation of mitochondrial biogenesis and the overall maintenance of cellular energy metabolism. The importance of MRPS6 is further underscored by its association with mitochondrial diseases, where mutations or dysregulation can lead to impaired respiratory function and increased oxidative stress. As a result, the investigation of MRPS6 recombinant protein has become a focal point for research aimed at elucidating its functions and mechanisms. Constructs of recombinant MRPS6 allow for in-depth studies, including its interaction with other mitochondrial proteins and its role in the assembly of mitochondrial ribosomes. Understanding these aspects may yield new insights into therapeutic targets for diseases linked to mitochondrial dysfunction. In addition, the characterization of MRPS6 may contribute to the development of biomarker assays for early diagnosis and monitoring of mitochondrial-related pathologies. Overall, the study of MRPS6 recombinant protein is essential for unraveling the complexities of mitochondrial biology and its implications for human health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US